PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G199300.1.p
Common NameSETIT_022265mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 413aa    MW: 45850.3 Da    PI: 6.9353
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G199300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.2e-344498155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+WtpeLH+rFv+av+qLGG+ekAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Seita.3G199300.1.p 44 KPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 98
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.38741101IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-324299IPR009057Homeodomain-like
SuperFamilySSF466898.6E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-234499IPR006447Myb domain, plants
PfamPF002497.7E-104697IPR001005SANT/Myb domain
PfamPF143792.8E-22145192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MYHQHQGPSE LFTTRTSFPM EQHLFLRGGN AQGDSGLVLS TDAKPRLKWT PELHQRFVDA  60
VNQLGGAEKA TPKTVMRLMG IPGLTLYHLK SHLQKYRLSK NLQAQANVST SKNAIGCTNI  120
ADRMPGTSAP TMSSTNAIPQ AEKTIQIGEA LQMQIEVQRQ LNEQLEVQRH LQLRIEAQGK  180
YLQAVLEQAQ ETLGKQNLGP ANLEDAKIKI SELVSQVSNE CFSNAITDIK ESSSVHRLEP  240
KQIQFVESST NNYLTAAEGF IKEHRLHHHG VLKAHDDSSL FCRKGSHEHE TPLALNRSLS  300
ERRMAHLQIE NGYSKAELGY ENDTEMAPEY IGPPKNGGGS TSSSASGSKG DAEKPYLEEP  360
NCTRQAVEYP RESKLLDFGH SCPGKKLDLN THNVDDTDQA YRHFDLNGFS WS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961696.10.0PREDICTED: uncharacterized protein LOC101755514
RefseqXP_004961697.10.0PREDICTED: uncharacterized protein LOC101755514
RefseqXP_004961698.10.0PREDICTED: uncharacterized protein LOC101755514
TrEMBLK3Z6U60.0K3Z6U6_SETIT; Uncharacterized protein
STRINGSi022265m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122793137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.36e-95G2-like family protein